DPCstruct | MC31568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 103 ± 20 aa |
| Standard deviation of domain lengths | 19.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3S619 | 9-115 | LPPWEERINEPLHTKRARLLYESRKRGMLENGIILSLFAKEYLNTMSEKQLSLYDKLINQPSNDWDIYYWATETKQTPPEFDSEVMT… |
| B6IT00 | 6-100 | TPPSSPDGLPPDGPTREARVKRLKFRSGHRGTKELDILFGAFAERHLDGMAAAELDAFERLLDLPDLEVYDWISGAAEPPAGPVGAL… |
| A0A2E2N3C8 | 2-88 | None |
| A0A066VRJ4 | 377-489 | None |
| D3SBG2 | 4-76 | None |
| A0A6N7EWE4 | 2-92 | None |
| A0A3N4KSF6 | 127-253 | None |
| J8TIU3 | 21-147 | None |
| M1VHE9 | 43-156 | None |
| K8E9H6 | 38-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.