DPCstruct | MC31564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536PWU0 | 65-179 | IDRNIGEDSEFHRMNGMYAEGVTLSTAVLPEGWRKRLVRFQPPTLYPVQALCLEPHDCVASKMVAGRSKDYDFANAMLARGLVSPGT… |
| A0A561QGM0 | 5-101 | NRLFGYLSNFDETHGFYIDGCDETTARLPPDWQKRAVYKTITARGRKVELIAPSIEDIPLSKLVRLVEKDRGWISSLHSSRPVDKPA… |
| A0A0K2RIA2 | 165-275 | None |
| A0A1W2A7S0 | 3-81 | None |
| A0A433BNE8 | 5-110 | None |
| A0A7V2NMF6 | 54-170 | None |
| A0A1H0ATY6 | 108-196 | None |
| A0A7Z1R971 | 62-169 | None |
| N1M6V4 | 2-125 | None |
| A0A849MDQ9 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.