DPCstruct | MC31562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9MQG2 | 1-76 | MSSVGTSSKMKGYGNNRADSTFIPGGVIPGYIVIKPDFPECIDDFGFLWFEDEYTISVAGSWILTANAADALVRQQ |
| W4UYP6 | 53-140 | LSYLYGTHADSDISFVSGVGAYNKRVAYGNNRADFSFIAGGVVPGIRLLKPDLPENRNDYPFIWSENEYVIDIAAAYILYVVAVNQMT |
| A0A7C2QMR3 | 246-334 | None |
| A0A7X9K1Q7 | 148-235 | None |
| A0A7X7U2L1 | 22-105 | None |
| A0A6I3N6H9 | 282-370 | None |
| A0A180EUF1 | 129-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.