DPCstruct | MC31561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8BY29 | 29-157 | YESAPWRTELRLHAVTIRESCECRYSEVPFSLERAILYSAFVLRKLMEDRKLTDEFCDRIVRAETFVAAAPEIGNFWRDLPGSVELN… |
| A0A317ZM20 | 1-132 | MIDDSRPWREELSRTARRLRARKDQTRWTERSHYLVERDIMVGAYAVRKLIDSEKTSSLLSKRQVQVVSYPLVGRRLYAMTNDQVDR… |
| A0A4R9A1F5 | 155-290 | None |
| E0RJ39 | 1-112 | None |
| A0A1F9HNQ6 | 1-105 | None |
| D4BIU8 | 1-140 | None |
| A0A090FSU1 | 1-139 | None |
| A0A396CFP7 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.