DPCstruct | MC31560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4Q747 | 604-665 | KVVSSAKEAIADLKDGSKLLVGGFGLCGIPENLIKAVQEKGTKNLTVVSNNAGVDDFGLGVL |
| A0A2N9M8Y0 | 3-58 | DHKPITSAAEAVADLYNGATVMTGGFGLCGFPENLLHALSERNVTNLYTISNNMGI |
| A0A1C4RSV0 | 180-243 | None |
| A0A0V0QVY3 | 15-90 | None |
| A0A182TMK1 | 65-127 | None |
| A9IEC8 | 2-58 | None |
| A0A4W3HWW4 | 5-69 | None |
| A0A1Q2D0C8 | 2-68 | None |
| A0A377X959 | 8-76 | None |
| A0A845BLN6 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.