DPCstruct | MC3156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 146 ± 21 aa |
| Standard deviation of domain lengths | 20.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4U7R0 | 2-110 | PEWDQLTKQQRQVMIDALRERWDDVPEERPRMYRHARRWLDMTPEQRKQAKAGMDRFRNMSPEQRREAKALFDRMRTLNPQQRNELQ… |
| A0A562WR97 | 12-154 | IMLFWGVTVFAEPARIPWQSLPPEEQNTLKPFADQWDTFSPERQERLQRGVERWRQMTPEERREAGQRFRRWQELPPEKREELRLKF… |
| A0A840S0U0 | 80-241 | None |
| A0A258R787 | 3-154 | None |
| A0A1F8ZJ04 | 21-150 | None |
| A0A1F2RTT9 | 7-139 | None |
| A0A3B8LS99 | 17-163 | None |
| A0A2W4TUK0 | 227-397 | None |
| A0A2V8WS47 | 100-261 | None |
| A0A651F9P8 | 134-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.