DPCstruct | MC31559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 162 |
|---|---|
| Mean domain length (aa) | 188 ± 22 aa |
| Standard deviation of domain lengths | 21.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352FDB2 | 14-201 | SSSISKTVIDEFLIYYAAVAYKLDRTMTEAFSAYRHVTNEFEKEWVNRLKAQYLAHQIFRSGGLIRKMLPHAELKKFSRTEMEFLEQ… |
| A0A2N9M4P9 | 5-167 | SQRAVKTIPREAYTEVGEALGIMRNGVLVFETEDVSSVLMDCCLYEWKDNGKSLIQRYVETHPGEPGTDEHYLLNACLPAKFRVLFP… |
| A0A4R0ZHG9 | 13-196 | None |
| A0A7X8HG80 | 116-319 | None |
| A0A849IK00 | 195-426 | None |
| A0A6J7INQ9 | 440-627 | None |
| T5ICS4 | 373-546 | None |
| A0A151YYW1 | 22-204 | None |
| A0A1V1P327 | 94-305 | None |
| A0A6N3C491 | 4-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.