DPCstruct | MC31557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0K2Y6 | 51-131 | YKRCPKCLLRTLKETTKELQSASYSRSGSKRISGDCRSCGHHTERTLTIPRKQSSSSGSSGRSGSSFGGGRSSGGGASGRW |
| A0A1Z4I9I1 | 194-270 | RCPHCEELTVTRTETTVVSPTQHNVGRRLITDKCHSCAYHNKTEEIIPRLPPPPPPPPPSSGGWGGGGGSDFGGGGG |
| A0A480AM09 | 13-85 | None |
| A0A844MHD3 | 116-193 | None |
| A0A7J5LG48 | 205-290 | None |
| A0A081BN61 | 168-253 | None |
| A0A3B8ZT13 | 138-220 | None |
| A0A0U2Z1H9 | 140-223 | None |
| A0A3R9M514 | 244-339 | None |
| A0A3D5PIJ1 | 98-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.