DPCstruct | MC31554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 473 ± 116 aa |
| Standard deviation of domain lengths | 115.94 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353UZN3 | 20-490 | TLVQLLQALERTLLDALENAEDVGFTVGYDRSDSDVPSVAHHEQNRYRSGFYPIVRVIADIWERLAQVAPERAIGLSRPWGQAPFVL… |
| A0A0M6ZMP9 | 2-389 | TLCRDAWLATADNNSENAKAMLTIWASSKHPVFRRLVFFALAQKPNLVSFDTSISWLLADDGHWLWLPSTMREVMRLLVSFGPILAA… |
| J2JP64 | 341-778 | None |
| A0A512BZP6 | 45-428 | None |
| A0A7Y3UB67 | 162-843 | None |
| A0A447G756 | 328-1035 | None |
| A0A5P6A9K4 | 75-439 | None |
| A0A525JQV9 | 211-570 | None |
| A0A499UZF7 | 1-320 | None |
| A0A1T2KZA2 | 16-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.