DPCstruct | MC31551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 218 ± 23 aa |
| Standard deviation of domain lengths | 22.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418VE37 | 1-208 | MARPRQRILDTGWSRLLEVGRETPGYGLYSYVLLPAHSPRAETFLARLFTEVPGIETLPAQLAQLNVLYVPLRQDKEGDFAALMTAS… |
| A0A432VAG4 | 292-483 | ENGIRATRIFAGPTQFPPRNFSAYGIVAFPSRASSGDRLDRYLMLCHAYVDGLPHADSPNLTTPYADQMVTVWPVEQDKLADQINKM… |
| A0A7S9LUG8 | 32-246 | None |
| A0A370KIV5 | 28-261 | None |
| A0A2K8U5J8 | 213-442 | None |
| A0A839VA13 | 115-321 | None |
| C6XRQ0 | 51-222 | None |
| A0A0S4LLW6 | 36-294 | None |
| A0A6I6EE14 | 8-223 | None |
| A0A1E5A7F1 | 438-665 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.