DPCstruct | MC31550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 313 ± 29 aa |
| Standard deviation of domain lengths | 29.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0505 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A323UIV2 | 1-326 | MVDKLLRDWDSQVAQSFKNIVGSTKPAIGAALAFYMKPGERPNSFEFLHKTFAEYLVARRIVKVVWSNAEDFARSRKEKSGRSKDFD… |
| A0A846GD92 | 146-449 | EDRLLKQGYKELQALIEKARQDEREDGLKNALAAFYLKSAAKAENSVEFFHKSFGEFLCAKRMVEGLEDLTEKTGKRRKTYVVSDEE… |
| A0A845X8M4 | 575-890 | None |
| A0A2W4YUT2 | 51-359 | None |
| A0A6M0G2R3 | 1-277 | None |
| A0A2E0QZN3 | 542-841 | None |
| U9VVD4 | 593-875 | None |
| A0A2T1E0G2 | 538-923 | None |
| A0A6P0LMC9 | 315-612 | None |
| K9F5F0 | 407-736 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.