DPCstruct | MC31546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 84 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822JSC7 | 6-83 | VEVQLEGPLFFAREDEERFFNWLYDLPAFRDVEGSGRVLHLRLTAPVDVDTVEQLLVICHRWKIDNAPLAPLKLGAVA |
| A0A2W4JNZ5 | 111-198 | EPGGFYCQLDEDHFFEWLQEIDGVKEVRGHATGLTVYLSVPVLSESALRDFIGLLFRYDVPMSFLRSQLTPKNEHWFKDPEKFWYEKI |
| A0A4Q5WZB0 | 2-83 | None |
| A0A2N1GF37 | 34-124 | None |
| A0A560K3M2 | 7-104 | None |
| A0A1X1QT26 | 1-74 | None |
| A0A0G9GZD1 | 13-110 | None |
| A0A645IR45 | 4-64 | None |
| A0A1G2W1W8 | 1-74 | None |
| A0A349L1I4 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.