DPCstruct | MC3154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G4D3T1 | 4-99 | NKKIFIVSILSILILSCVFTNPSKNEYVNWSKEQMQSQSSNILEKGLVGFLGDKIISNTTTTKNYIIFSIYKTEMENEKLTTLGILK… |
| A0A168W031 | 1-90 | MKKVLIIVGILIMMAITNPDKTEFVIFAEGLALNKSEGFIEEVAAYLFAEKTAEIVTESQNYVIFSIYTLPGVDGKDINFIGLFDNF… |
| A0A424HC35 | 2-119 | None |
| A0A285CUG9 | 2-95 | None |
| A0A7G6AB07 | 1-106 | None |
| M1V8B5 | 228-329 | None |
| A0A6P1ADU9 | 14-131 | None |
| A0A855Y0K2 | 44-138 | None |
| A0A354WEB1 | 12-131 | None |
| A0A6G3YZ36 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.