DPCstruct | MC3153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0F990 | 10-102 | LSKDLIVGHVYRYDGNEQVYYFENSPSNIANFIMLHKEHANKMILTDRLDRLVLNTFGEFINRCPNQELLQKILKDLVPMQMGDKDP… |
| A0A165NWQ4 | 2-90 | NEFVYGYVDGEQVMIANTVEQVCAFIMKYKYESVKITNFFDELLIETSMGFIMYCRDQTYLANNLLPTLAPMQMGDTEIPEFVPYKE… |
| A0A3E2N5E5 | 14-105 | None |
| A0A6I3R6W8 | 16-96 | None |
| A0A3A6DWJ9 | 2-75 | None |
| A0A1C5Y0E6 | 14-111 | None |
| A0A316S436 | 2-94 | None |
| A0A2S7RTD7 | 1-73 | None |
| A0A1H7QAF0 | 66-163 | None |
| A0A7G8TF06 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.