DPCstruct | MC31524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 217 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7W3K5 | 1-227 | MDERIRSDSILALGQKIVDELGIDQSTDTLGRWMAHYIAEKMEDAEAATGEARDKKMSECNDLILKLWAHRSDLSNGQRPFEDFEPI… |
| U4EFJ4 | 19-229 | ENLETQEKVINLGKKLISSFQENDLDYITAWMINYLSEQILLAENGDEEAKKQCFNTIIQLWESRSVFPDGTRPFENFEPIFKALDS… |
| A0A1X2LC34 | 1-207 | None |
| A0A1G5HYV6 | 1-231 | None |
| A0A4Q3BZV8 | 2-230 | None |
| A0A6I3MFD1 | 1-234 | None |
| A0A366MVQ6 | 2-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.