DPCstruct | MC31522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 288 ± 41 aa |
| Standard deviation of domain lengths | 40.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B5ZLU9 | 2-300 | FAGLFDCTRRSSLDSGDTMNDVFSFAGILLKPLEWIGGSKVIDFDKPLHRAVKKALHLVAAHERRVYRPLVPLGPLKSGWDESLLPG… |
| A0A4P7BIH1 | 37-271 | QAIAHGVEEVRHFVAAHEIRNSFPVDSIWVATNGRIEVVNQFHERVYPGAHSDVGGGYRPGEGGKSLKANEKLSQIPLHHMYEAAIA… |
| A0A5C4PWW1 | 46-354 | None |
| A0A4V1LB87 | 318-567 | None |
| A0A833NDF9 | 263-537 | None |
| A0A447L614 | 109-322 | None |
| A0A2K4MJN1 | 77-449 | None |
| A0A6N6WDW3 | 261-553 | None |
| A0A127QRB8 | 222-473 | None |
| A0A855FMJ7 | 167-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.