DPCstruct | MC31521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 123 ± 7 aa |
| Standard deviation of domain lengths | 6.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830C6R7 | 30-152 | NVPEIHLFNARFKEHIGDVSSARAALTLCDTKTDSSFVENVVMLANLERRLGNLAAASDTYKKSLKNAKEKRKTRVLPNLYFHFAQF… |
| A0A833Y4W2 | 1-135 | MLISLLTCSLQRVPVIHLFNSRFKEQIGDTAGARASLQQCESESASNFVENVKLKANMEKRMGNFNAASNVYKEAIEMAATKKMLHT… |
| A0A6P8DXV1 | 271-395 | None |
| A0A453BDL4 | 1-116 | None |
| A0A5A7NZT0 | 357-466 | None |
| A0A7J6GUD7 | 526-650 | None |
| A0A6A1V9V6 | 383-503 | None |
| A0A5B6ZIU3 | 349-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.