DPCstruct | MC31520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 263 ± 44 aa |
| Standard deviation of domain lengths | 44.40 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17975 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8Y351 | 1-194 | MNESLKLLSDLVYYMKYSRYIPELKRRETWPETVQRNKEMHLVKYAHIPAIHPYIEKAYEFVLDKKILPSGRSLQFGGGAILKNHNK… |
| A0A1G7X0D7 | 1-287 | MRFLEESIIEKYKNLTPPFTELGKFVYYRTYSRWLEDKGRRENWLETCERVVNYSLSLEYKHRIKNNLPVDIQKMKKEAEILFDNMF… |
| A0A8A3LUK8 | 75-365 | None |
| A0A2H0RB03 | 2-240 | None |
| A0A7X7BAQ7 | 8-264 | None |
| A0A1Y1XU27 | 39-333 | None |
| A0A2K3AT16 | 2-273 | None |
| A0A0G0TXD2 | 122-381 | None |
| A0A1E4LL15 | 4-206 | None |
| A0A6N9Q8M9 | 1-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.