DPCstruct | MC31516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 183 ± 40 aa |
| Standard deviation of domain lengths | 39.66 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.73 |
| Pfam Score | 88.62 |
| Assigned Pfam label(s) | PF12571- PF09718- CL0064- PF10983 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T0N978 | 3-168 | DPPPTPATGARYIIGAAPTGHWAGHDSEIAVWDGMIWRFVMPQPGWRADVSPTGQSLRFDGSDWQTVLPQLQNLPALGVGATADASN… |
| A0A3B9YSI0 | 3-172 | NSTNLQMPLLAAAQAQKHVTVNSALQKLDLLVQLGVQSRTLAAPPVNPTDGSRYIVAAAPTGAWAGQAGKVAAWQDGVWTFLTPRAG… |
| A0A2N4WRK1 | 128-253 | None |
| A0A2P7SCU7 | 1-200 | None |
| A0A1X7NWA9 | 3-223 | None |
| A0A2D2CWJ8 | 2-238 | None |
| A0A2T4JD18 | 691-896 | None |
| A0A2E1CTG0 | 21-141 | None |
| A0A1A9G110 | 55-169 | None |
| A0A4R7BY72 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.