DPCstruct | MC3150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I0ZZY8 | 4-74 | LILFLSLLSAVFGHHILCIQNVPSRSHHTLMMGIVKPLLEAGHQVTMITTFPEEKPAKNLRYIDVGHLRDL |
| A0A2M4DQC1 | 7-89 | ASAVCLVILVVVFGDSGASGYRILGFNTSPSRSHVIVQDALMKELARRGHQVTMISPYKESESVPNYRKITIPIESWSKGMRP |
| A0A7R9HRT5 | 1-86 | None |
| A0A2R7VRP7 | 53-130 | None |
| A0A2R7VZK1 | 18-80 | None |
| A0A4C1TM00 | 31-118 | None |
| A0A194PJL3 | 155-227 | None |
| A0A3Q0ITK3 | 4-83 | None |
| T1GMQ9 | 53-123 | None |
| A0A4C1U5A2 | 3-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.