DPCstruct | MC315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0H5Z4 | 200-274 | EHFNVPLLRDIYPYNFFTKKYLNLPVGDITLAGWIDSDRGRGVLTRLTDKVMMWEPVVENIPAIRETLFRAGVMF |
| A0A518C0S6 | 26-135 | HQLYNHGILRDIYLDNFLTHHQLDADVLGQALRDWITSSPDHGVLEHYCQDIYRWSVPEDKIQPVTDVMWKAGRLLTRDEAEEYVYQ… |
| A0A2Z3I7P2 | 2-73 | None |
| C3KMF6 | 105-179 | None |
| A0A5C9BDT0 | 202-275 | None |
| A0A559J0J4 | 28-101 | None |
| A0A1B9NSB1 | 1-79 | None |
| A0A7X0RYQ0 | 76-149 | None |
| A0A357KYX5 | 35-112 | None |
| A0A1T3VP41 | 190-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.