DPCstruct | MC31499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 436 ± 104 aa |
| Standard deviation of domain lengths | 104.09 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 22.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01618 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378PYL0 | 11-370 | ETKFFIAFIFVFALVFHIAYNKNISEKAPTFLTTLGIFATFFAIARGLLEFNALNITSSVPALLESMKTAFWASVFGVGSALTFKLR… |
| A0A377HZD9 | 4-414 | TLIFSFLMVIVFLAVAFSFYNRENQLGKFGFRIMSSAPTILTSMGILGTFVGISYSLLEFNTNDLDKSIPILLDGMKIAFLTSAIGM… |
| A0A077DCU7 | 14-475 | None |
| A0A447QNJ6 | 17-348 | None |
| A0A1T4LJB9 | 15-583 | None |
| A0A0C3RHJ4 | 4-269 | None |
| A0A1Q3PBX5 | 1-297 | None |
| A0A2U8FBQ2 | 3-526 | None |
| A0A812XAU7 | 291-680 | None |
| A0A3N4VRD2 | 16-601 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.