DPCstruct | MC31497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 295 ± 57 aa |
| Standard deviation of domain lengths | 56.59 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.08 |
| Pfam Score | 51.91 |
| Assigned Pfam label(s) | PF05090- CL0213- CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4VUC1 | 16-331 | SLVAFRIAAGLLALYDALIKFPHIRWLYSTDGYRDFSAEFFSRSLWIHQLIANLSLQQWQMLIGLQAIAGIFLIIGWRPKVWLVVWL… |
| Q9A359 | 3-222 | LELARRLVEILLALALIQQSLEHLRGFRDERILFGARIVLAVLVLAGVAGPWPLVGLAGLSLLILHRFQGPYNGGSDRMGLLILWCL… |
| A0A2A3Z7T0 | 23-307 | None |
| A0A7S4E654 | 57-333 | None |
| A0A2E4HEW8 | 419-743 | None |
| A0A2E5G114 | 26-303 | None |
| A0A6I7YLS1 | 2-273 | None |
| A0A7W8E600 | 5-228 | None |
| A0A7I8CC30 | 64-427 | None |
| U2HTZ3 | 189-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.