DPCstruct | MC31495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 20.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.66 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | CL0722- CL0697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376VM99 | 90-244 | SFNRVGLDHVLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKSWAAGDATSRAVRLALMAKTGEMGYPSA… |
| A0A2G6NUT8 | 22-150 | ATLTQFVSPFVAGRIYGLNQDQMVAAAGISGSSHFTLGGVVAGHLTNMKNTADPLATQAGVLAALMAREGYEGPVEVIEGKEGFQHV… |
| A0A2I0RTI2 | 383-538 | None |
| A0A661QQ54 | 2-110 | None |
| A0A6B2E1Z9 | 8-136 | None |
| A0A1F4DSF8 | 1-119 | None |
| A0A5N6KXG6 | 750-921 | None |
| A0A2I0TN98 | 51-195 | None |
| A0A6N9YK10 | 62-192 | None |
| A0A5N6KYV1 | 233-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.