DPCstruct | MC31494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12076 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M8CI45 | 21-114 | NLVRVVDEGLHEAMKQLLLRPETRSHLALSCSYSSKVWLVGDALTGQEQERAEPGAHFVPYSQFPPSGDARADCVYHSTPALMVPES… |
| A0A287RIL8 | 1-92 | MMTLSTERFQKIQKEAAAEHQQYLVQVTKFQSAEQCRTWIVGKWLSPREQRWASPGTHFHQFVVPPILGFRRDCTYGKLAAMRLPKD… |
| A0A7J9KHH4 | 49-145 | None |
| A0A7J0FWP5 | 94-194 | None |
| A0A1D1YCN8 | 876-963 | None |
| A0A1D1YK90 | 226-310 | None |
| A0A1U8PU78 | 410-500 | None |
| A0A5B6WA41 | 186-290 | None |
| A0A396I4I8 | 2-99 | None |
| A0A811NTD3 | 29-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.