DPCstruct | MC31491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 157 ± 22 aa |
| Standard deviation of domain lengths | 22.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04935 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PFZ9 | 15-185 | PLTEPKLEKIAKAPKPVFNSQGKLVFSKFDFSEMGAQGTGKSGLKSKGPKSPGKILQKIQRHKEKLQQLESEGKTEAAQELKQKEAW… |
| A0A2J7PZW7 | 27-147 | DPHKMLKKIEKQNEKLKDLEATGEIGKLTEIREKIAWNRALSKSEGVKVKDNPELLKKTIKKEIQQKQKSKRKWDARTEGMKNRRDE… |
| K7GWK5 | 4-149 | None |
| A0A3P7IWA7 | 208-368 | None |
| A0A1I7VNJ7 | 734-880 | None |
| A0A183HHR6 | 2-168 | None |
| A0A7T8QVS4 | 7-141 | None |
| A0A072VB89 | 113-224 | None |
| I3S636 | 3-132 | None |
| A0A397SAA7 | 358-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.