DPCstruct | MC31488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 166 ± 32 aa |
| Standard deviation of domain lengths | 32.40 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PDX8 | 1-137 | MTLDKEYDVAVQAVKLVISILKHHRDILTDKDCEHVYELVYSSHRAVAQAAGEFLNERLFVPDEEAVAGIRTKRGKKRLPNTPLIRD… |
| A0A822GKY1 | 49-250 | LELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSDEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSCREPDDDGILKR… |
| A0A5J5D315 | 347-495 | None |
| A0A453HVJ1 | 2-183 | None |
| A0A2G9SCH5 | 28-161 | None |
| A0A1S3QRL1 | 2-156 | None |
| A0A553NLB9 | 1035-1189 | None |
| A0A183HQR5 | 92-229 | None |
| A0A668SIU4 | 2-140 | None |
| A0A2V3J680 | 49-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.