DPCstruct | MC31487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9P815 | 9-68 | KSGASPTRRTVNCYLCGREFGSLSIAIHEPQCLNKWHLENSKLPTHQRRPEPVKPDIRFT |
| A0A232F0L4 | 366-417 | RPRSVTCYICGREFGTASFPIHEPKCLQKWHRENKTLPNSQRRNEPQRPNVP |
| A0A7M4F145 | 3-72 | None |
| A0A368GFU2 | 7-67 | None |
| A0A139WEI0 | 746-814 | None |
| F6VFX2 | 72-143 | None |
| A0A2K1ITR2 | 5-61 | None |
| A0A7R9AUT9 | 340-412 | None |
| T1G0S2 | 2-62 | None |
| A0A4Y2GDM2 | 300-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.