DPCstruct | MC31485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 157 ± 22 aa |
| Standard deviation of domain lengths | 21.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H5C9N9 | 26-187 | YNLSEPEGVYPLDGSHSGINKYPDFQPWKHTVKEDHIAVDHLQRGYFESPQVGNELLSARNIMHQLLRSKNSLESLSSNVLMAMDLR… |
| A0A6A4JAF6 | 57-183 | FSYEKRYLKRPKLGPPDVYPQEPKQKEDELTVTNVKHGFTYPQLAEEFGSARNYNVTASKVGAYFNAIMEKKDEYNTLPDSGRKRQQ… |
| B3RM14 | 1-162 | None |
| A0A7R8CKU8 | 7-126 | None |
| D0IQM6 | 6-156 | None |
| A0A819GJD8 | 1-128 | None |
| J4IAQ4 | 22-170 | None |
| U7PRJ7 | 411-594 | None |
| A0A183M5C6 | 1-159 | None |
| A0A317BL80 | 114-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.