DPCstruct | MC31480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 264 ± 42 aa |
| Standard deviation of domain lengths | 41.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L6JLN5 | 40-248 | YASENQLVFELDLRNSIIKAAIALYNSNFSFMVFRKSECNPDYWHRTNEGGFLLKRNVTPSDAVKDIYINSSLYGTECSTAMVIVYY… |
| A0A158E9W4 | 31-289 | RMSAIGSNLIQLPHRVIEWFRQAEQNYGKNCFYSMDLQKIILEKNAGKLQELGLGGMDFKARIKLANNGKTDGFLATSKDFALMANE… |
| A0A831TME7 | 5-210 | None |
| A0A2N5GKX0 | 26-239 | None |
| A0A0W0SD18 | 20-350 | None |
| A0A6S6YK57 | 37-257 | None |
| Q6MBU4 | 19-333 | None |
| A0A6A6BUJ5 | 89-429 | None |
| E2CLJ8 | 391-635 | None |
| A0A420RWW5 | 947-1240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.