DPCstruct | MC3148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 190 ± 22 aa |
| Standard deviation of domain lengths | 21.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8BCC4 | 14-212 | LTLINTSLCDKRLNRQKRFIEMADDVRGPYCETKPGGPCCPGRDDQCTVPILDSICYCDMFCNITASDCCPDFKRICIGGNPEPITR… |
| A0A493TE69 | 9-192 | GLYEHGVYDAGGSYCQRGDVCCHGRDDGCTVPYLDTICYCDLFCNRTVSDCCPDFWEYCLGIPPCAHPGSPLSHPGCARAGRTYPSG… |
| A0A0S7HVV7 | 39-167 | None |
| A0A670YNL7 | 23-236 | None |
| A0A1E1WMM7 | 1-184 | None |
| A0A4C1UEZ5 | 1-188 | None |
| G0P7Q9 | 1-182 | None |
| L9JHT2 | 571-769 | None |
| A0A7J5XA26 | 26-194 | None |
| A0A210QBT7 | 26-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.