DPCstruct | MC3147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 96 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F8A420 | 77-171 | YVEETILPSNSVEGRFAEAMYNAFWNHLEEQLLSTPPDFTCALELLKDVKETLLSLLLPWQNRLRNEIEEALDTDLLKQEAEHGALD… |
| A0A3B4F999 | 33-130 | RDFCFKPRNPSTDSLEGRVTEIVHRAFWDSLQEQLNSDPPNYSHAVLLLQEVKTMLQSLLLPAHVRLRSQLDEVLDMDLIGQEVDHG… |
| A0A6I9MY47 | 24-117 | None |
| A0A803YG44 | 1-107 | None |
| B4DZS4 | 68-161 | None |
| A0A8B6D6S0 | 95-190 | None |
| A0A668T924 | 24-117 | None |
| A0A7R9QFB7 | 138-233 | None |
| A0A250Y0T8 | 20-108 | None |
| A0A2P4T8H0 | 82-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.