DPCstruct | MC31462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 384 ± 60 aa |
| Standard deviation of domain lengths | 59.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0I9XG84 | 31-392 | VELERGTPFPFAASGKPPDSPRSAYELITLELAYFISNHNDNVGSLPSHESLQLEACRIMFASEVTFPEANLDTHGSPSWFRDLLLS… |
| A0A0B7KM36 | 390-778 | HNHHACQKRLKEERIFSRKDHLGQHLRLVHNSQFMKGLMEEWKSMYEQIRSRCGFCDLEMDTWTERASHLAGHFKEGSTMADWKGSW… |
| A0A135S342 | 257-798 | None |
| X0CTV8 | 553-965 | None |
| T0LJB5 | 26-306 | None |
| C9S7E8 | 2-308 | None |
| W9NDU1 | 463-820 | None |
| N4VMC1 | 322-679 | None |
| A0A5M9LLZ7 | 299-756 | None |
| A0A0D2YB67 | 442-810 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.