DPCstruct | MC3146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.19 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0123- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A493T7G3 | 12-116 | KEGASQCKEKHAVLLSPVGKLEISGCETGLHEIKLPKMSVLPNGAEASAGCEVCEGAEGMTEPLKQCTAWLRAYFCEPARTEQLPVP… |
| A0A6P6P5M0 | 4-88 | SGSCVLREVTLSSPVGEILLSGCEKGVHTINIKLGTEKDESVQPVGRSEMSPELQHCVDWLQCYFMKPESVSALPLPTLHNPLMQ |
| A0A6P4U8J0 | 1-95 | None |
| A0A834AIF9 | 1-106 | None |
| A0A4X2KX13 | 27-124 | None |
| A0A2K6K3M5 | 11-122 | None |
| B5X6V9 | 1-87 | None |
| T1JPG9 | 1-86 | None |
| A0A4X1V935 | 23-125 | None |
| A0A7J7JZU4 | 10-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.