DPCstruct | MC31458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 127 ± 26 aa |
| Standard deviation of domain lengths | 25.94 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.61 |
| Pfam Score | 95.46 |
| Assigned Pfam label(s) | CL0164- CL0159- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3R2T9 | 44-176 | LLVKAEGTEKSHTYNWLLCPTGEALTEEVEVQLPQNVVAGSARISLSVLGDILGRALNNLDGLLQMPYGCGEQNMALLSPNIYILEY… |
| A0A443QD16 | 16-138 | ECETVYQNSANLVMLNASRTSYNRTFNINLPQIFVPDSERISVSVIGDMLGAAITNIDDLLREPYGCGEQNMVNFVPNIVALNYLTK… |
| T1GP20 | 32-195 | None |
| A0A1I8FR87 | 132-270 | None |
| A0A4Y2CAE8 | 1-91 | None |
| A0A7R9Q8H4 | 152-274 | None |
| A0A182TQH4 | 485-613 | None |
| S4RR00 | 72-188 | None |
| A0A3Q2U6W9 | 1-85 | None |
| A0A564Y022 | 188-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.