DPCstruct | MC31454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 172 ± 21 aa |
| Standard deviation of domain lengths | 21.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 33.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444UW98 | 62-203 | IVGGVDLLAKAEEQEKLLEESNNELDERKKKAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQE… |
| G5BMR2 | 1-169 | MNEQQKILEQKWQEIAEQKCREREIQQQMESRDQETLELKETYSSLQQEVDIKTKKLKKLFSKLQEVKAGIHDLQEEHIKECQELEQ… |
| A0A3P7LNQ6 | 129-310 | None |
| W2SK47 | 432-615 | None |
| A0A7S3T343 | 3-148 | None |
| A0A830H9P5 | 92-277 | None |
| A0A6G0YN77 | 509-690 | None |
| H2ZYC9 | 1-169 | None |
| A0A2T7PIF4 | 679-877 | None |
| A0A821CC44 | 133-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.