DPCstruct | MC31450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3P0R0 | 5-98 | NSDPCESPPVITVKEPIGERDDISLYGTPKEEIGPGLGEVNPKSFMRNQIEALFQASDNKLAMKLFGSKKALMKERLRQKESGLWII… |
| E2BZX9 | 5-88 | GSGKVHFGVDDVSLYGTPKEEPGPGLPGQEVKQSFLKNQLQALFQPTDNKLAMKLFGSKKALMKERIRQKAAGHWVIHPCSSFR |
| A0A6P7FT27 | 197-293 | None |
| A0A177AZE1 | 383-490 | None |
| A0A448WJ09 | 237-331 | None |
| A0A212F2B3 | 37-118 | None |
| A0A1A8JS56 | 46-143 | None |
| A0A674DZU2 | 77-175 | None |
| A0A834KH94 | 4-135 | None |
| A0A183KM87 | 218-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.