DPCstruct | MC31447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VX28 | 325-412 | QQRPLTRYLPITNQQFDLRQHIESAGHQLEMCHQVVISRHACRGYLHKLSSRIRSWQKRWFVFDRSKNKRTFMYYSDKSESKARGGVY |
| A0A7R9F1S3 | 53-129 | QRPLTRYLPIRSESLNLRAHIESAGHQVELCPHVLLDSTSCRGFLHKMGSKFHHWNKRWFVFDRSKRMLVYYADRTE |
| A0A833SBR8 | 22-110 | None |
| E4YYC5 | 526-605 | None |
| S9XJB4 | 715-820 | None |
| A0A7R9DRH2 | 1-82 | None |
| A0A1J1HKY1 | 787-874 | None |
| A0A7M7KVW4 | 502-577 | None |
| A0A7I8WDA9 | 333-423 | None |
| A0A7R9IT92 | 54-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.