DPCstruct | MC31445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 184 ± 26 aa |
| Standard deviation of domain lengths | 25.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.93 |
| Pfam Score | 84.56 |
| Assigned Pfam label(s) | CL0220- CL0013- PF00015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2G5U1 | 111-292 | LEDLLFHTVAEGQEKIPAHKFLTALKATGLRTGDPRLKECMDTLKETLRNTSDGVTLDRHLFKKCVQSNIVLLTQAFRKKFVIPDFQ… |
| T1IPF4 | 122-334 | NVDDILFALFKNEENLVPVGKFLAALRATGLRKTDPRLRELMNNLKTVREQKFGEIGSAEALTLDKETFKSVILENIVLISRAFRGQ… |
| A0A1Q8FRS1 | 29-242 | None |
| A0A6J8APP7 | 65-202 | None |
| A0A2R7VR35 | 99-297 | None |
| A0A3D3S5K7 | 5-144 | None |
| A0A0S2EF40 | 68-258 | None |
| A0A6P9A761 | 63-259 | None |
| K7GYT5 | 2-209 | None |
| A0A6P8GK46 | 105-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.