DPCstruct | MC31443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 237 ± 26 aa |
| Standard deviation of domain lengths | 26.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8MGM3 | 3-231 | PNMVKFIKQVGHLLQWKEVYCFQKFFPILTRWQVMNATRLKEMPTAVVYVAPKEIVKKRVVKGIPSLEIIWQDEKGIFNGLVPESQL… |
| A0A4Z2FZA4 | 38-268 | DKPVSHFKRRQPNMLMIQKFANDKMEWPKHYTSEKVLVLITYAEMMNRKYGREMSSQIKPLRILKPRVRNAVACFEVVWSAPEHYVF… |
| A0A6D2IJW4 | 306-585 | None |
| A0A6L5D3V9 | 135-300 | None |
| A0A0C9X6T4 | 176-407 | None |
| A0A0X3P1U5 | 137-357 | None |
| A0A446UGR0 | 250-508 | None |
| A0A1I8I744 | 98-320 | None |
| A0A183RZY5 | 2-241 | None |
| M7CMC9 | 230-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.