DPCstruct | MC31441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 301 ± 45 aa |
| Standard deviation of domain lengths | 45.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7ITV0 | 35-327 | PFCLSLKYLEGIEVKSTNPATEYQNIYFYTSVKDIDVLVVFELIAVENHDGKVRRVNRGWTFLRPFASDNVTDVSSNKEPTAQRLSM… |
| A0A0K0DQ19 | 2-298 | SCYFFDAKTAQFFGGPYQSVERRPGRNECGLDDDLFFHCPHLDDAVHLVIEVIEKNTNVNAIQQPVTLAWGLLKINGYLETVPEYSR… |
| A0A0N4WFF3 | 1-378 | None |
| A0A401SJZ8 | 48-397 | None |
| A0A2I3MZK4 | 138-435 | None |
| A0A3M0IYT4 | 44-395 | None |
| A0A0N5D7L6 | 10-302 | None |
| P59240 | 41-395 | None |
| A0A4U5LZJ2 | 5-272 | None |
| A0A3B4BGB8 | 2-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.