DPCstruct | MC3144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 88 ± 5 aa |
| Standard deviation of domain lengths | 5.48 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0645 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495N7X8 | 1-89 | MSEHQHGRDDCVDYIERIVYLLDNELDQADCAVVQMHLQECGPCLERYDLQRAVKQLVQRSCSEAAPQGLRDRVRLQLREVTVQITE… |
| A0A7X7K6Z6 | 1-89 | MSTHDDGPQGERVDCAQAIDQLFEFLDAEMDDARGDLIRVHLASCEQCLAEYDVVDHIKALVKRSCGERAPEELHVRIRTQLTVLRA… |
| M0QE66 | 7-98 | None |
| A0A448KFU0 | 3-84 | None |
| A0A839XMR8 | 1-95 | None |
| C5C1Q8 | 1-96 | None |
| A0A852ZB05 | 4-86 | None |
| U5WA28 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.