DPCstruct | MC31439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 167 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.64 |
| Pfam Score | 91.54 |
| Assigned Pfam label(s) | CL0023- CL0357- CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2FTS8 | 1-166 | MFSVGQESISTSPASTKGPGRRKSRFALCRRNKANGVKASTVHPSCTPQAAKAVSNKEQHSISYTLSRAQTVVVEYNHDGHTDMFQI… |
| A0A7S4E7U7 | 28-191 | VYGQLVVLGYKEYRVEGSTWHPVGARNEKFALARRDEANGIRRARARVGEPRRPGEKRRSADASHSVTMSVAAGARGADGKPVARSQ… |
| A0A654H2D3 | 4-185 | None |
| A0A7R9P9Z9 | 47-189 | None |
| A0A7J7VJL7 | 25-193 | None |
| A0A1I8G795 | 510-666 | None |
| A0A834XKW6 | 112-276 | None |
| A0A6S8UDS2 | 28-191 | None |
| A0A5K3ERC3 | 3-186 | None |
| A0A669CNP2 | 150-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.