DPCstruct | MC31436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2N6Y2 | 1-115 | MATPAPQSDDWDESQLLDNLRKLDELHRRLINLRTVIPTILYPLHAQYSTPTDLFHDFASRAASCSDDIAKFTTMYVHSSSILSHAE… |
| M2MNP0 | 2-104 | SSETWNEQQYHDALAHLERLQQQLDGLRSVLPTIVAPLLQKDASQGGMFASVKKAALQSTDDLDRFRKEWSSDQTQQLLTRSNESVK… |
| A0A6A6BLZ0 | 1-99 | None |
| A0A559M8C2 | 13-145 | None |
| A0A136IUX9 | 1-116 | None |
| A0A1V8TWS6 | 1-108 | None |
| A0A0G2GC70 | 1-139 | None |
| S3CW94 | 1-133 | None |
| A0A0P7BHJ0 | 1-133 | None |
| A0A2C5XTH8 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.