DPCstruct | MC31435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 107 ± 15 aa |
| Standard deviation of domain lengths | 14.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J7JC73 | 1-99 | MTKKWEEHKATIISFYKEQHKPLHEVKRLMEEQYGFEASVRAYRSRFDRWGVYKYNCRRPGGSTTDESGGDSPASDRSHFSPKREEP… |
| F9F5K0 | 6-103 | WAEHKTTIVELYRNEGKTLNDVRSIMKRDHRFNASIRSYKSYFAKWQIRKYNCKKRIDKCRITPTAKAPAPGSRPPPPNVPIKKEVG… |
| A0A2J6QEL0 | 1-97 | None |
| T0KYP2 | 1-137 | None |
| L2G9T1 | 1-93 | None |
| F7W657 | 2-105 | None |
| A0A423WJ70 | 1-97 | None |
| A0A2P5ICR6 | 1-129 | None |
| A0A4U6XRR1 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.