DPCstruct | MC31432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 157 ± 17 aa |
| Standard deviation of domain lengths | 17.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5EVZ6 | 1-158 | MWIAMEMFPLAYHQEQQAVKPQLIARGRKFGSFSGKDYKFYEGLAFFRDKKEGIIRLMVNSRIMGPVKFVAGRYTQSPKTEDEQTDT… |
| A0A175VUL4 | 260-415 | REELIERGKRYHRIICDGQSHMRYNGSVIAEKAYHYQGEIIVDHQSYKLEALDSRSMEMPDISGEEPQDLRGEPLFSKFNDMECSAA… |
| A0A0D9P9G1 | 844-1003 | None |
| A0A5C3QPM8 | 50-187 | None |
| A0A395NL49 | 496-689 | None |
| A0A0G2JAU4 | 262-399 | None |
| A0A7C8P2L2 | 249-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.