DPCstruct | MC31430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 295 ± 69 aa |
| Standard deviation of domain lengths | 68.99 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.23 |
| Pfam Score | 99.47 |
| Assigned Pfam label(s) | CL0123- PF20411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2NGY5 | 2-182 | SARYGGNTQSRCPKISQALVAVHGMDDFMYLNNEMQPVAPSVPCAPGLFIGREGSQYTTGIKRQLIRLDAKQWLYVGQYQLARSEPA… |
| A0A5J5ERJ3 | 17-314 | ANNPNRSATPGVFSLSEPNTDALRVRNALPAAQAPQARHAPQKPAAPNVATAGHANGNNGDLTIEQVISNVVPPPGAYDGAPNHHQG… |
| A0A5C2SH03 | 340-618 | None |
| A0A1Z5T0A9 | 232-575 | None |
| A0A2T6ZKQ9 | 3-218 | None |
| A0A165ZTR2 | 136-581 | None |
| A0A4Y7TVE4 | 88-462 | None |
| A0A4Y7TUJ0 | 631-1014 | None |
| A0A4Y7TV52 | 9-199 | None |
| A0A2H3BYT5 | 39-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.