DPCstruct | MC3143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 179 ± 21 aa |
| Standard deviation of domain lengths | 20.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8NF84 | 227-397 | QKHVFMDQAAAHLAYEQGGLDAIREMRAAGLLDDKAVGAWRDIDSGGDERVGRGNAVLLDREQNQILPEQWNSMYRRHAPVGPALTY… |
| A0A7X7HWA5 | 1-181 | EGIAGLEEMHRAGLFGDDIMEAWHDVASGDPDRIAHGNMTLLNREQGWVVSDMWDGVRAYKDGLGEAFTYLMTLAGSPSVAGVPALR… |
| A0A163L6A0 | 177-400 | None |
| A0A535ENX1 | 2-173 | None |
| G7H2Z6 | 335-515 | None |
| A0A2H4SAI8 | 160-312 | None |
| A0A2U1ZKZ4 | 78-301 | None |
| A0A4R1WH80 | 118-295 | None |
| A0A1X1AUC2 | 24-206 | None |
| A0A0Q9NTE4 | 286-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.