DPCstruct | MC31428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 179 ± 32 aa |
| Standard deviation of domain lengths | 31.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9WRM0 | 564-708 | FKGSLHCEAALGTLISTPASETYPQYSSLLAEMQQYGRVIGTSKRCCPVCAALLSIITPQGTAQPFLIRGSHRTISSCTLPDWTPPR… |
| A0A5J5EKT4 | 8-166 | EVVKTIYPDPDEHTVIIDDGVPHCEAVLACLHYLASSGESIDPSVVSQDVLDQLKKAAPLIAPSKRCCPVCAAIQHELSSGRPGKYP… |
| A0A1G4BMG5 | 220-372 | None |
| A0A409XVH2 | 7-185 | None |
| L2FDN2 | 318-512 | None |
| A0A0C3B381 | 256-460 | None |
| A0A3M7M653 | 44-213 | None |
| A0A3N4LAN1 | 436-633 | None |
| A0A4Y7QC99 | 127-256 | None |
| A0A3N4I5H7 | 112-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.