DPCstruct | MC31424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 314 ± 54 aa |
| Standard deviation of domain lengths | 54.03 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 72.50 |
| Assigned Pfam label(s) | CL0357- PF12423- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267FBM7 | 6-287 | DKAKSSSAEDMLLMDDLVKLYPQVQEANAMSEELDRRVRFELVLMSPQGRGLRENEGRTEVYISLTNLDSGNEFFWSKDKFSDRKYL… |
| A0A0D6LW05 | 60-357 | GIAEGGKSKVILADLILEEELISTMPLVYRANAMAVELKRNVKFELVLVSPEMRGLQEGLTEIWVSVHNLTEDTRFMWEKARFMNRY… |
| A0A1S3J029 | 39-339 | None |
| A0A834PU01 | 325-654 | None |
| A0A183LSR4 | 53-402 | None |
| A0A3M6WJD9 | 607-858 | None |
| S4RE50 | 40-349 | None |
| A0A7S3ZL57 | 582-945 | None |
| A0A816RXR4 | 104-414 | None |
| A0A2H2ITV0 | 8-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.